VIMSS147183 has 112 amino acids
Query: DUF413 [M=90]
Accession: PF04219.17
Description: Protein of unknown function, DUF
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.4e-43 131.9 0.1 3.9e-43 131.7 0.1 1.0 1 VIMSS147183
Domain annotation for each sequence (and alignments):
>> VIMSS147183
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 131.7 0.1 3.9e-43 3.9e-43 1 88 [. 10 97 .. 10 99 .. 0.98
Alignments for each domain:
== domain 1 score: 131.7 bits; conditional E-value: 3.9e-43
DUF413 1 rFyDdknfprGfsrsGdFtikeaelLeqyGvalkaLeegelepeteeeeqfvevvkgekaaetelekvWlkYlklikgkkrvhtlvgt 88
rF+D+k++prGfsr+GdFtikea+lLe++G+a+++L++g++ep+teee++fv+v++ge+++ ++ ekvW+kY+ +++++kr+htl+g
VIMSS147183 10 RFFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNELDSGKREPVTEEEQRFVAVCRGEREPVSAEEKVWSKYVIRTRQPKRFHTLSGG 97
8************************************************************************************986 PP
Or compare VIMSS147183 to CDD or PaperBLAST