VIMSS147597 has 128 amino acids
Query: DUF3461 [M=125] Accession: PF11944.12 Description: Protein of unknown function (DUF3461) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-59 184.5 1.7 4.3e-59 184.4 1.7 1.0 1 VIMSS147597 Domain annotation for each sequence (and alignments): >> VIMSS147597 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 184.4 1.7 4.3e-59 4.3e-59 1 125 [] 1 125 [. 1 125 [. 0.99 Alignments for each domain: == domain 1 score: 184.4 bits; conditional E-value: 4.3e-59 DUF3461 1 myehLksigitepdeierytLrqeaeadiLkiyfkkekgellaksvkfkfprqrkkilvdsgseeyknvseinatLrqvldeLdkltekekaeadikk 98 my++Lks+git+p+ei+ry+Lrqea++diLkiyf+k++ge++aksvkfk+prqrk++ d + yk+v+ei+++Lr+v+deLd++ +++++e d+k+ VIMSS147597 1 MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKSVKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKR 98 9************************************************************************************************* PP DUF3461 99 klLedlkhlervvqdkikeierdlekl 125 k+L+dl+hle+vv++ki+eie+dl+kl VIMSS147597 99 KILDDLRHLESVVANKISEIEADLDKL 125 *************************97 PP
Or compare VIMSS147597 to CDD or PaperBLAST