PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS148231 to PF07214 (DUF1418)

VIMSS148231 has 96 amino acids

Query:       DUF1418  [M=94]
Accession:   PF07214.16
Description: Protein of unknown function (DUF1418)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.5e-50  153.5   2.5    6.2e-50  153.4   2.5    1.0  1  VIMSS148231  


Domain annotation for each sequence (and alignments):
>> VIMSS148231  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.4   2.5   6.2e-50   6.2e-50       1      94 []       1      94 [.       1      94 [. 0.99

  Alignments for each domain:
  == domain 1  score: 153.4 bits;  conditional E-value: 6.2e-50
      DUF1418  1 mrslgklPksvlilevlGlillvvallsvndylslPaelsspeaailmiflGvllllPaavaivwrvasalapqlmkrsPdkssrskrekknds 94
                 mr++g lPksvlile+lG+ill++alls+n+yl+lPa++++p+a +lm+flGv+l+lPaava++wr+a++lapqlmkr+Pd+ssrs+rek+n+s
  VIMSS148231  1 MRTIGVLPKSVLILEYLGMILLALALLSLNHYLTLPAPFNTPLAGVLMVFLGVVLILPAAVAMMWRIAQLLAPQLMKRPPDISSRSDREKHNES 94
                 9******************************************************************************************985 PP



Or compare VIMSS148231 to CDD or PaperBLAST