VIMSS148446 has 56 amino acids
Query: DUF3950 [M=30] Accession: PF13132.10 Description: Domain of unknown function (DUF3950) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-26 77.7 3.3 3.3e-26 77.3 3.3 1.2 1 VIMSS148446 Domain annotation for each sequence (and alignments): >> VIMSS148446 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 77.3 3.3 3.3e-26 3.3e-26 1 30 [] 21 50 .. 21 50 .. 1.00 Alignments for each domain: == domain 1 score: 77.3 bits; conditional E-value: 3.3e-26 DUF3950 1 mleQIeiaLekektsNFSAWVkEACRekLc 30 mleQIe+aL++ekt+NFSAWVkEACRekLc VIMSS148446 21 MLEQIEFALKSEKTRNFSAWVKEACREKLC 50 9***************************** PP
Or compare VIMSS148446 to CDD or PaperBLAST