PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS148446 to PF13132 (DUF3950)

VIMSS148446 has 56 amino acids

Query:       DUF3950  [M=30]
Accession:   PF13132.10
Description: Domain of unknown function (DUF3950)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.4e-26   77.7   3.3    3.3e-26   77.3   3.3    1.2  1  VIMSS148446  


Domain annotation for each sequence (and alignments):
>> VIMSS148446  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   77.3   3.3   3.3e-26   3.3e-26       1      30 []      21      50 ..      21      50 .. 1.00

  Alignments for each domain:
  == domain 1  score: 77.3 bits;  conditional E-value: 3.3e-26
      DUF3950  1 mleQIeiaLekektsNFSAWVkEACRekLc 30
                 mleQIe+aL++ekt+NFSAWVkEACRekLc
  VIMSS148446 21 MLEQIEFALKSEKTRNFSAWVKEACREKLC 50
                 9***************************** PP



Or compare VIMSS148446 to CDD or PaperBLAST