VIMSS148622 has 83 amino acids
Query: DUF333 [M=48]
Accession: PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4e-25 74.2 0.0 4.9e-25 74.0 0.0 1.1 1 VIMSS148622
Domain annotation for each sequence (and alignments):
>> VIMSS148622
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.0 0.0 4.9e-25 4.9e-25 1 48 [] 31 77 .. 31 77 .. 0.98
Alignments for each domain:
== domain 1 score: 74.0 bits; conditional E-value: 4.9e-25
DUF333 1 gmaNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrgd 48
gm+NPA+vyC+qqGG+l +v++++ g C+Lp+Ge ++eW+l+r++
VIMSS148622 31 GMPNPAAVYCEQQGGTLMPVQTPQ-GVRSDCKLPNGEIIDEWTLWRRE 77
7***********************.*********************85 PP
Or compare VIMSS148622 to CDD or PaperBLAST