VIMSS148782 has 79 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.3e-22 64.4 5.9 4e-22 64.2 5.9 1.1 1 VIMSS148782
Domain annotation for each sequence (and alignments):
>> VIMSS148782
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 64.2 5.9 4e-22 4e-22 1 47 [. 12 57 .. 12 58 .. 0.99
Alignments for each domain:
== domain 1 score: 64.2 bits; conditional E-value: 4e-22
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47
sPC g+C+ d e+g+CrGC+R++dE+++W++msd e+++vl+ +++r
VIMSS148782 12 SPCRGICQSD-ERGFCRGCMRSRDERFNWQKMSDVEKQNVLRLCRQR 57
9*********.**********************************99 PP
Or compare VIMSS148782 to CDD or PaperBLAST