VIMSS148925 has 73 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-27 82.0 4.1 1.4e-27 81.7 4.1 1.1 1 VIMSS148925
Domain annotation for each sequence (and alignments):
>> VIMSS148925
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.7 4.1 1.4e-27 1.4e-27 1 48 [. 23 70 .. 23 71 .. 0.97
Alignments for each domain:
== domain 1 score: 81.7 bits; conditional E-value: 1.4e-27
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIk 48
+yv+tTk+GqtivtqgkP+lDk+tGm++Y+d+eG++++In++dV q +
VIMSS148925 23 NYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLI 70
7********************************************976 PP
Or compare VIMSS148925 to CDD or PaperBLAST