VIMSS149012 has 84 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-20 58.2 5.7 4.1e-20 57.8 5.7 1.2 1 VIMSS149012
Domain annotation for each sequence (and alignments):
>> VIMSS149012
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.8 5.7 4.1e-20 4.1e-20 2 49 .] 30 77 .. 29 77 .. 0.97
Alignments for each domain:
== domain 1 score: 57.8 bits; conditional E-value: 4.1e-20
DUF903 2 yvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIke 49
y++tT++G++i tqgkPe+D+ tGm++Y d +G +++++++++ q +e
VIMSS149012 30 YTMTTRTGEIIETQGKPEVDTATGMTKYADVYGYHRVMKTSEIVQTTE 77
********************************************9987 PP
Or compare VIMSS149012 to CDD or PaperBLAST