VIMSS149273 has 79 amino acids
Query: DUF2492 [M=77]
Accession: PF10678.13
Description: Protein of unknown function (DUF2492)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.4e-40 122.5 0.4 3.8e-40 122.4 0.4 1.0 1 VIMSS149273
Domain annotation for each sequence (and alignments):
>> VIMSS149273
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 122.4 0.4 3.8e-40 3.8e-40 2 77 .] 3 78 .. 2 78 .. 0.99
Alignments for each domain:
== domain 1 score: 122.4 bits; conditional E-value: 3.8e-40
DUF2492 2 siHgHevlelllasgesltrasLkeaieekFGeearFhtCsaedltaeeLiefLlkkgKfiesedglttnaekiCn 77
siHgHevl+++++sge++t+ sL++ai+++FGe arFhtCsa+d+ta+eL++fL++kgKfi+ edg++t+++kiC+
VIMSS149273 3 SIHGHEVLNMMIESGEQYTHTSLEAAIKARFGERARFHTCSASDMTAAELVAFLAAKGKFIAVEDGFSTHESKICR 78
8**************************************************************************6 PP
Or compare VIMSS149273 to CDD or PaperBLAST