VIMSS149459 has 238 amino acids
Query: DUF1266 [M=175]
Accession: PF06889.15
Description: Protein of unknown function (DUF1266)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.3e-23 68.0 1.8 8.1e-23 67.6 1.8 1.2 1 VIMSS149459
Domain annotation for each sequence (and alignments):
>> VIMSS149459
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.6 1.8 8.1e-23 8.1e-23 68 175 .] 88 229 .. 15 229 .. 0.67
Alignments for each domain:
== domain 1 score: 67.6 bits; conditional E-value: 8.1e-23
DUF1266 68 e....................kveryyerlgeegil............................AWDlgRavnlarwgyqagylseeeawelllkaar 117
+ l A+D R ++l+r+ + +g+++ +aw +ll a+
VIMSS149459 88 KkelglsenldgaalrhkvedI-------------LrrwpagigssprtfyhhlaaqgqvrdalAFDCMRTAFLTRCIAGLGWCDVHQAWLVLLLNAQ 172
1223455544444444433330.............24444444456666666666666669999********************************** PP
DUF1266 118 kaqraYssWeefaasyllGrlfwqgededdaaseykemlealeeLlsdpdspWrrlpW 175
+aq ++sWe++a++y+ r +w ++ +a + l+ ++ +l+dp s Wr+lpW
VIMSS149459 173 RAQDCFDSWEDYATAYVRARRVWLTLRDTPTAL-AGRDLQEATHYLQDPVSRWRQLPW 229
**************************9977555.5999999999************** PP
Or compare VIMSS149459 to CDD or PaperBLAST