VIMSS153469 has 181 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-23 67.2 2.6 3.9e-20 58.4 0.0 2.2 2 VIMSS153469 Domain annotation for each sequence (and alignments): >> VIMSS153469 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.4 0.0 3.9e-20 3.9e-20 11 79 .] 31 99 .. 29 99 .. 0.98 2 ! 8.4 1.1 0.00016 0.00016 1 20 [. 122 141 .. 122 144 .. 0.93 Alignments for each domain: == domain 1 score: 58.4 bits; conditional E-value: 3.9e-20 CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 ll l+eRm l+k++a+yK +++lp+ d Re+ v+++++e+a+++gldp+ ++ ++r ++++s+a+Q+ VIMSS153469 31 LLTALNERMLLMKDVAAYKMKHHLPIEDFTREQNVFAEAEEEAKNNGLDPHSITPFIRSLMDASKAIQY 99 899****************************************************************96 PP == domain 2 score: 8.4 bits; conditional E-value: 0.00016 CM_2 1 RkeIdeiDrelleLlaeRme 20 R++I ++D+++l ++++R+ VIMSS153469 122 RQRIRQLDNQMLIIISQRLM 141 9*****************85 PP
Or compare VIMSS153469 to CDD or PaperBLAST