PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS153655 to PF07151 (DUF1391)

VIMSS153655 has 51 amino acids

Query:       DUF1391  [M=48]
Accession:   PF07151.16
Description: Protein of unknown function (DUF1391)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.3e-40  121.2   0.3    6.8e-40  121.1   0.3    1.0  1  VIMSS153655  


Domain annotation for each sequence (and alignments):
>> VIMSS153655  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  121.1   0.3   6.8e-40   6.8e-40       2      47 ..       3      48 ..       2      49 .. 0.97

  Alignments for each domain:
  == domain 1  score: 121.1 bits;  conditional E-value: 6.8e-40
      DUF1391  2 kiDLGnnesLvCGvfPnqDGtftamtytksktfktetGarrWLekh 47
                  iDLGnnesLvCGvfPnqDGtftamtytksktfkte+GarrWL +h
  VIMSS153655  3 TIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRH 48
                 59******************************************99 PP



Or compare VIMSS153655 to CDD or PaperBLAST