VIMSS15415 has 81 amino acids
Query: DUF2543 [M=81]
Accession: PF10820.12
Description: Protein of unknown function (DUF2543)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.3e-54 167.4 1.2 3.6e-54 167.3 1.2 1.0 1 VIMSS15415
Domain annotation for each sequence (and alignments):
>> VIMSS15415
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 167.3 1.2 3.6e-54 3.6e-54 1 81 [] 1 81 [] 1 81 [] 1.00
Alignments for each domain:
== domain 1 score: 167.3 bits; conditional E-value: 3.6e-54
DUF2543 1 mendvplkyydivdeyatesaePveeeerdalaryfqllitrltnneeiseeaqkemaaeaginekrideiaeflnqwGne 81
m++d+plky+di+deyate+aePv+e+er++la+yfqll+trl+nneeiseeaq+emaaeagin++rideiaeflnqwGne
VIMSS15415 1 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE 81
9*******************************************************************************8 PP
Or compare VIMSS15415 to CDD or PaperBLAST