VIMSS15529 has 768 amino acids
Query: DUF2773 [M=81] Accession: PF10971.12 Description: Protein of unknown function (DUF2773) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-50 154.3 3.5 9.4e-50 153.0 2.7 2.2 2 VIMSS15529 Domain annotation for each sequence (and alignments): >> VIMSS15529 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.44 0.44 11 31 .. 517 537 .. 511 547 .. 0.73 2 ! 153.0 2.7 9.4e-50 9.4e-50 1 81 [] 688 768 .] 688 768 .] 0.99 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.44 DUF2773 11 llaaeiePedrilainnPrla 31 ll+ +Pe ++ n l+ VIMSS15529 517 LLTRFNDPEGWSNLAKNQYLS 537 788899999998666665555 PP == domain 2 score: 153.0 bits; conditional E-value: 9.4e-50 DUF2773 1 alrnahtPalllaaeiePedrilainnPrlavdvkkarlkedPllllelvqPeldllrdlvktGktrkireearrkleeky 81 al+n+htP+++laaei+Pe++i+a+nnPr++vdv+karlk+dPll lelv+Peldl+r+l+++Gktr+ire+a+rkl+e+y VIMSS15529 688 ALNNRHTPPAVLAAEIDPEWWIVAMNNPRFPVDVLKARLKRDPLLALELVNPELDLVRQLALNGKTRAIREQAMRKLDELY 768 8******************************************************************************97 PP
Or compare VIMSS15529 to CDD or PaperBLAST