VIMSS15544 has 447 amino acids
Query: DUF1338 [M=169] Accession: PF07063.17 Description: Domain of unknown function (DUF1338), C-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-70 221.1 0.0 1.1e-69 220.1 0.0 1.5 1 VIMSS15544 Domain annotation for each sequence (and alignments): >> VIMSS15544 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 220.1 0.0 1.1e-69 1.1e-69 2 169 .] 196 401 .. 195 401 .. 0.98 Alignments for each domain: == domain 1 score: 220.1 bits; conditional E-value: 1.1e-69 DUF1338 2 vsledyeeLkeeselaAdvvsfegyhiNHlTprvldidavqealeergiklkdeieGppkrspdilLrQtsfkAleeevefaeedgeeeegsvtarfgE 100 v++e+y++L++e++l+Advv+f g+hiNHlTpr+ldid+vq+++ e gi++k ieGpp+r+ +ilLrQtsfkAlee+v fa g++ +g++tarfgE VIMSS15544 196 VDEETYRALHNEHRLIADVVCFPGCHINHLTPRTLDIDRVQSMMPECGIEPKILIEGPPRREVPILLRQTSFKALEETVLFA---GQK-QGTHTARFGE 290 789******************************************************************************9...555.499******* PP DUF1338 101 ieqRgaaltpkGralydellkea...................fpddeeelrkegLayfr.......................ieeglveaepilyedFl 157 ieqRg+altpkGr+lyd+ll++a fpd+e +r++gLa+fr ie+g+v a+pi+yedFl VIMSS15544 291 IEQRGVALTPKGRQLYDDLLRNAgtgqdnlthqmhlqetfrtFPDSEFLMRQQGLAWFRyrltpsgeahrqaihpgddpqplIERGWVVAQPITYEDFL 389 *************************************************************************************************** PP DUF1338 158 pasAagIFesnl 169 p+sAagIF+snl VIMSS15544 390 PVSAAGIFQSNL 401 **********97 PP
Or compare VIMSS15544 to CDD or PaperBLAST