VIMSS15567 has 77 amino acids
Query: DUF2526 [M=77]
Accession: PF10735.13
Description: Protein of unknown function (DUF2526)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.5e-51 157.4 5.4 5e-51 157.3 5.4 1.0 1 VIMSS15567
Domain annotation for each sequence (and alignments):
>> VIMSS15567
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 157.3 5.4 5e-51 5e-51 1 77 [] 1 77 [] 1 77 [] 0.99
Alignments for each domain:
== domain 1 score: 157.3 bits; conditional E-value: 5e-51
DUF2526 1 mshldevkvkvdaaleesviahmnellialsddaqlsreerytqqqrlrtaiahhGrqekedaearreqltkGGkil 77
mshldev+++vdaa+eesviahmnellialsdda+lsre+rytqqqrlrtaiahhGr++ked+ear eqltkGG+il
VIMSS15567 1 MSHLDEVIARVDAAIEESVIAHMNELLIALSDDAELSREDRYTQQQRLRTAIAHHGRKHKEDMEARHEQLTKGGTIL 77
9**************************************************************************97 PP
Or compare VIMSS15567 to CDD or PaperBLAST