VIMSS156823 has 175 amino acids
Query: DUF308 [M=73] Accession: PF03729.18 Description: Short repeat of unknown function (DUF308) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-37 113.8 63.4 1.3e-22 66.2 11.9 3.0 3 VIMSS156823 Domain annotation for each sequence (and alignments): >> VIMSS156823 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.2 11.9 1.3e-22 1.3e-22 1 73 [] 11 82 .. 11 82 .. 0.96 2 ! 46.2 18.6 2.3e-16 2.3e-16 3 73 .] 70 140 .. 68 140 .. 0.93 3 ! 26.6 16.9 3e-10 3e-10 2 46 .. 127 171 .. 126 175 .] 0.91 Alignments for each domain: == domain 1 score: 66.2 bits; conditional E-value: 1.3e-22 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilsiiaGllllf 73 l Gi++iilG+++l++Pg++ll++++++G+lll+sGi++ +++f+ rk+++ ++w l+ Gilsi++G+lllf VIMSS156823 11 LAGIAMIILGVWFLFHPGISLLTSTLMFGFLLLISGIFHTISYFSDRKSQNVSGW-VLADGILSILLGFLLLF 82 57**********************************************9999988.788************97 PP == domain 2 score: 46.2 bits; conditional E-value: 2.3e-16 DUF308 3 GilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilsiiaGllllf 73 Gil+i+lG+l+l++ + +l+lv+l+G+++l++Gi++ ++af+a++++ +g + l +Gi+ ii+G+++lf VIMSS156823 70 GILSILLGFLLLFNEFDGTLTLVLLFGMWVLFAGIMRTIGAFTAKQNNVQGWGWILTIGIIGIIVGFIALF 140 9*****************************************88887776655***************997 PP == domain 3 score: 26.6 bits; conditional E-value: 3e-10 DUF308 2 lGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaa 46 +Gi+ ii+G++al++P+++++ +v++++++++v Gi +++ f+ VIMSS156823 127 IGIIGIIVGFIALFNPVVSAIGIVLVVAIFFIVQGIGAIATFFFI 171 7**************************************877754 PP
Or compare VIMSS156823 to CDD or PaperBLAST