VIMSS15693 has 51 amino acids
Query: DUF1391 [M=48]
Accession: PF07151.16
Description: Protein of unknown function (DUF1391)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.5e-38 114.2 0.3 1e-37 114.1 0.3 1.0 1 VIMSS15693
Domain annotation for each sequence (and alignments):
>> VIMSS15693
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 114.1 0.3 1e-37 1e-37 2 46 .. 3 47 .. 2 49 .. 0.96
Alignments for each domain:
== domain 1 score: 114.1 bits; conditional E-value: 1e-37
DUF1391 2 kiDLGnnesLvCGvfPnqDGtftamtytksktfktetGarrWLek 46
iDLGnnesLv GvfPnqDGtftamtytksktfkte GarrWLe+
VIMSS15693 3 TIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLER 47
59******************************************8 PP
Or compare VIMSS15693 to CDD or PaperBLAST