VIMSS15769 has 79 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-23 68.2 5.2 2.9e-23 67.8 5.2 1.1 1 VIMSS15769
Domain annotation for each sequence (and alignments):
>> VIMSS15769
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.8 5.2 2.9e-23 2.9e-23 1 47 [. 12 57 .. 12 58 .. 0.98
Alignments for each domain:
== domain 1 score: 67.8 bits; conditional E-value: 2.9e-23
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47
sPC g+C+ d e+g+CrGC+R++dE+++W++msd e+++vl+ +++r
VIMSS15769 12 SPCRGICQSD-ERGFCRGCFRSRDERFNWNKMSDGEKQEVLRLCRQR 57
9*********.***********************************9 PP
Or compare VIMSS15769 to CDD or PaperBLAST