VIMSS157824 has 361 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.8e-21 61.3 0.1 1e-20 60.2 0.1 1.6 1 VIMSS157824
Domain annotation for each sequence (and alignments):
>> VIMSS157824
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 60.2 0.1 1e-20 1e-20 1 79 [] 10 87 .. 10 87 .. 0.96
Alignments for each domain:
== domain 1 score: 60.2 bits; conditional E-value: 1e-20
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R+++d+++ +lleL+++R++l++ei+++K ++g +dp Re+e+l+ + + a+e +++++v+k+f+ei+++ ++lQ+
VIMSS157824 10 RTQVDQLNIDLLELISKRANLVQEIGKIKGTQGSLRFDPLREREMLNTILA-ANEGPFEDSTVQKLFKEIFKAGLELQE 87
99*************************************************.56677*******************996 PP
Or compare VIMSS157824 to CDD or PaperBLAST