VIMSS158688 has 111 amino acids
Query: DUF898 [M=336] Accession: PF05987.17 Description: Bacterial protein of unknown function (DUF898) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-14 38.3 10.2 3.7e-11 28.7 3.8 2.0 2 VIMSS158688 Domain annotation for each sequence (and alignments): >> VIMSS158688 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 14.4 0.5 8.3e-07 8.3e-07 271 311 .. 22 62 .. 15 65 .. 0.70 2 ! 28.7 3.8 3.7e-11 3.7e-11 3 40 .. 64 101 .. 62 111 .] 0.85 Alignments for each domain: == domain 1 score: 14.4 bits; conditional E-value: 8.3e-07 DUF898 271 rrlvwlllsnllltlltLGlllpwakvrlaryllesltvea 311 ++++ + +l+tl+t+G+ +pwa + +++++ +e+ VIMSS158688 22 LQYIGWTILGTLVTLCTFGICYPWALCMVYGWKINHTVIEG 62 45666667777788888888888888777777777776665 PP == domain 2 score: 28.7 bits; conditional E-value: 3.7e-11 DUF898 3 rvaFtGsggeyfriwivNllLtivTLGiYsaWakvrtr 40 r++F+Gs+ +f+ wi llLti+T+GiY +W + + VIMSS158688 64 RLKFQGSAVGLFGHWIKWLLLTIITIGIYGFWVFIKLE 101 799*****************************866655 PP
Or compare VIMSS158688 to CDD or PaperBLAST