VIMSS158792 has 204 amino acids
Query: DUF1648 [M=49] Accession: PF07853.15 Description: Domain of unknown function (DUF1648) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-17 49.6 3.5 1.2e-17 49.6 3.5 2.3 3 VIMSS158792 Domain annotation for each sequence (and alignments): >> VIMSS158792 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 3.5 1.2e-17 1.2e-17 1 49 [] 10 58 .. 10 58 .. 0.97 2 ? -3.6 0.5 0.5 0.5 4 8 .. 89 93 .. 86 103 .. 0.47 3 ? -2.8 0.1 0.29 0.29 6 14 .. 120 129 .. 116 131 .. 0.48 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 1.2e-17 DUF1648 1 llillplvlglilypkLPdqiPtHfnasGepDgygsKlfglfllPllll 49 ++il+++ ++++lyp LP+++++Hf+ + pD ++ K+ gl+l+P+l++ VIMSS158792 10 MIILFTVGISAVLYPLLPSEVAVHFGTDFSPDMFMQKWLGLILIPFLMI 58 59*********************************************96 PP == domain 2 score: -3.6 bits; conditional E-value: 0.5 DUF1648 4 llplv 8 ll+++ VIMSS158792 89 LLTII 93 44433 PP == domain 3 score: -2.8 bits; conditional E-value: 0.29 DUF1648 6 plvlgli.ly 14 ++v++++ y VIMSS158792 120 MFVVAAYiQY 129 4444443255 PP
Or compare VIMSS158792 to CDD or PaperBLAST