PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS158792 to PF07853 (DUF1648)

VIMSS158792 has 204 amino acids

Query:       DUF1648  [M=49]
Accession:   PF07853.15
Description: Domain of unknown function (DUF1648)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.2e-17   49.6   3.5    1.2e-17   49.6   3.5    2.3  3  VIMSS158792  


Domain annotation for each sequence (and alignments):
>> VIMSS158792  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   49.6   3.5   1.2e-17   1.2e-17       1      49 []      10      58 ..      10      58 .. 0.97
   2 ?   -3.6   0.5       0.5       0.5       4       8 ..      89      93 ..      86     103 .. 0.47
   3 ?   -2.8   0.1      0.29      0.29       6      14 ..     120     129 ..     116     131 .. 0.48

  Alignments for each domain:
  == domain 1  score: 49.6 bits;  conditional E-value: 1.2e-17
      DUF1648  1 llillplvlglilypkLPdqiPtHfnasGepDgygsKlfglfllPllll 49
                 ++il+++ ++++lyp LP+++++Hf+ +  pD ++ K+ gl+l+P+l++
  VIMSS158792 10 MIILFTVGISAVLYPLLPSEVAVHFGTDFSPDMFMQKWLGLILIPFLMI 58
                 59*********************************************96 PP

  == domain 2  score: -3.6 bits;  conditional E-value: 0.5
      DUF1648  4 llplv 8 
                 ll+++
  VIMSS158792 89 LLTII 93
                 44433 PP

  == domain 3  score: -2.8 bits;  conditional E-value: 0.29
      DUF1648   6 plvlgli.ly 14 
                  ++v++++  y
  VIMSS158792 120 MFVVAAYiQY 129
                  4444443255 PP



Or compare VIMSS158792 to CDD or PaperBLAST