VIMSS15942 has 47 amino acids
Query: DUF2527 [M=38] Accession: PF10736.13 Description: Protein of unknown function (DUF2627) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-35 105.0 2.7 7.9e-35 104.8 2.7 1.0 1 VIMSS15942 Domain annotation for each sequence (and alignments): >> VIMSS15942 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.8 2.7 7.9e-35 7.9e-35 1 38 [] 1 38 [. 1 38 [. 1.00 Alignments for each domain: == domain 1 score: 104.8 bits; conditional E-value: 7.9e-35 DUF2527 1 mCGIFSKEVLSKdVdVEYRFSAePYlsASsSNvSvLSm 38 mCGIFSKEVLSK+VdVEYRFSAePY++AS+SNvSvLSm VIMSS15942 1 MCGIFSKEVLSKHVDVEYRFSAEPYIGASCSNVSVLSM 38 *************************************9 PP
Or compare VIMSS15942 to CDD or PaperBLAST