VIMSS15954 has 78 amino acids
Query: DUF1480 [M=78]
Accession: PF07351.17
Description: Protein of unknown function (DUF1480)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.4e-47 144.1 0.0 5.9e-47 144.0 0.0 1.0 1 VIMSS15954
Domain annotation for each sequence (and alignments):
>> VIMSS15954
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 144.0 0.0 5.9e-47 5.9e-47 3 78 .] 2 77 .. 1 77 [. 0.99
Alignments for each domain:
== domain 1 score: 144.0 bits; conditional E-value: 5.9e-47
DUF1480 3 ktklrisafeiddavlsseqkgertlsiPcksdpdlcmqldawdeetsiPailngkdsllyrkhydrqkdawvmrv 78
kt +ri+afeidd +l++e g+rtl+iPcksdpdlcmqldawd+etsiPa+lng++s+lyr +yd+q+daw+mr+
VIMSS15954 2 KTSVRIGAFEIDDGELHGESPGDRTLTIPCKSDPDLCMQLDAWDAETSIPALLNGEHSVLYRTRYDQQSDAWIMRL 77
89************************************************************************97 PP
Or compare VIMSS15954 to CDD or PaperBLAST