VIMSS15955 has 63 amino acids
Query: DUF1482 [M=57]
Accession: PF07358.15
Description: Protein of unknown function (DUF1482)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-39 119.8 0.3 1.9e-39 119.7 0.3 1.0 1 VIMSS15955
Domain annotation for each sequence (and alignments):
>> VIMSS15955
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 119.7 0.3 1.9e-39 1.9e-39 1 57 [] 1 57 [. 1 57 [. 1.00
Alignments for each domain:
== domain 1 score: 119.7 bits; conditional E-value: 1.9e-39
DUF1482 1 mFaLVlfVcylnggcqdlvvgvYdteqeClaaaeeQkirnggCyPveevidnyerPA 57
mFaLVlfVcyl+ggc+d+vv+vY+teq+Cl+++++Q+ir+ggC+P+e++id+++rPA
VIMSS15955 1 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFIDGFWRPA 57
9*******************************************************9 PP
Or compare VIMSS15955 to CDD or PaperBLAST