VIMSS16254 has 79 amino acids
Query: DUF2542 [M=79]
Accession: PF10808.12
Description: Protein of unknown function (DUF2542)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.7e-50 154.7 5.7 4e-50 154.6 5.7 1.0 1 VIMSS16254
Domain annotation for each sequence (and alignments):
>> VIMSS16254
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 154.6 5.7 4e-50 4e-50 1 79 [] 1 79 [] 1 79 [] 1.00
Alignments for each domain:
== domain 1 score: 154.6 bits; conditional E-value: 4e-50
DUF2542 1 mdvktifvviavllvplfclreaykGwraGavdkvvknarepvyvyraedpllyfsylvlylglgvlslgmiiyllfyr 79
mdv+++fvv++++l+p+fc+rea+kGwraGa+dk+vkna+epvyv+ra++p+l+f+y+v+y+g+g+ls+gmi+yl+fyr
VIMSS16254 1 MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVAYIGFGILSIGMIVYLIFYR 79
9*****************************************************************************9 PP
Or compare VIMSS16254 to CDD or PaperBLAST