VIMSS16482 has 80 amino acids
Query: DUF2545 [M=80]
Accession: PF10810.12
Description: Protein of unknown function (DUF2545)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-45 138.7 11.2 3.1e-45 138.6 11.2 1.0 1 VIMSS16482
Domain annotation for each sequence (and alignments):
>> VIMSS16482
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 138.6 11.2 3.1e-45 3.1e-45 1 80 [] 1 80 [] 1 80 [] 0.99
Alignments for each domain:
== domain 1 score: 138.6 bits; conditional E-value: 3.1e-45
DUF2545 1 miYllvilalailavslyigsvlgavsaissllgmviLaaliyfltlwltdGnelvsGilllLsPaiGllivfmvsygkR 80
mi l+++lal+i++vs+yig+vl++vsa+ss++gmviLaaliy++t+wlt+Gnelv+Gi+++L+Pa+Gl+i+fmv+yg+R
VIMSS16482 1 MINLWMFLALCIVCVSGYIGQVLNVVSAVSSFFGMVILAALIYYFTMWLTGGNELVTGIFMFLAPACGLMIRFMVGYGRR 80
899***************************************************************************99 PP
Or compare VIMSS16482 to CDD or PaperBLAST