VIMSS16603 has 63 amino acids
Query: DUF2633 [M=43] Accession: PF11119.13 Description: Protein of unknown function (DUF2633) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-32 97.6 5.0 1.7e-32 97.3 5.0 1.1 1 VIMSS16603 Domain annotation for each sequence (and alignments): >> VIMSS16603 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.3 5.0 1.7e-32 1.7e-32 1 43 [] 7 49 .. 7 49 .. 0.98 Alignments for each domain: == domain 1 score: 97.3 bits; conditional E-value: 1.7e-32 DUF2633 1 mrrrrrknsrmtRiVLLISFiiLlGRlvYssiGAiehHqdKkq 43 mr+r+r+nsrmtRiVLLISFi+++GR++Yss+GA++hHq+Kk+ VIMSS16603 7 MRKRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKE 49 89***************************************96 PP
Or compare VIMSS16603 to CDD or PaperBLAST