VIMSS16603 has 63 amino acids
Query: DUF2633 [M=43]
Accession: PF11119.13
Description: Protein of unknown function (DUF2633)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-32 97.6 5.0 1.7e-32 97.3 5.0 1.1 1 VIMSS16603
Domain annotation for each sequence (and alignments):
>> VIMSS16603
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 97.3 5.0 1.7e-32 1.7e-32 1 43 [] 7 49 .. 7 49 .. 0.98
Alignments for each domain:
== domain 1 score: 97.3 bits; conditional E-value: 1.7e-32
DUF2633 1 mrrrrrknsrmtRiVLLISFiiLlGRlvYssiGAiehHqdKkq 43
mr+r+r+nsrmtRiVLLISFi+++GR++Yss+GA++hHq+Kk+
VIMSS16603 7 MRKRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKE 49
89***************************************96 PP
Or compare VIMSS16603 to CDD or PaperBLAST