PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS16876 to PF04287 (DUF446)

VIMSS16876 has 109 amino acids

Query:       DUF446  [M=98]
Accession:   PF04287.17
Description: tRNA pseudouridine synthase C
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.3e-39  118.6   2.6    5.9e-39  118.4   2.6    1.0  1  VIMSS16876  


Domain annotation for each sequence (and alignments):
>> VIMSS16876  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  118.4   2.6   5.9e-39   5.9e-39       2      98 .]       7     103 ..       6     103 .. 0.98

  Alignments for each domain:
  == domain 1  score: 118.4 bits;  conditional E-value: 5.9e-39
      DUF446   2 vaelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwiflprmkalieaeqpLPkavaiapmaeealkeeeeeaaellallkelDel 98 
                 v+ +L++lea Lre+++W++++p++++++st+PF++dt+e+ eWLqw+++prm+ l++++qpLP a+a+ap++e+al++++ ++a +la+l++lD+l
  VIMSS16876   7 VRLQLQALEALLREHQHWRNDEPQPHQFNSTQPFFMDTMEPLEWLQWVLIPRMHDLLDNKQPLPGAFAVAPYYEMALATDHPQRALILAELEKLDAL 103
                 6789*******************************************************************************************86 PP



Or compare VIMSS16876 to CDD or PaperBLAST