VIMSS16876 has 109 amino acids
Query: DUF446 [M=98] Accession: PF04287.17 Description: tRNA pseudouridine synthase C Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-39 118.6 2.6 5.9e-39 118.4 2.6 1.0 1 VIMSS16876 Domain annotation for each sequence (and alignments): >> VIMSS16876 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 118.4 2.6 5.9e-39 5.9e-39 2 98 .] 7 103 .. 6 103 .. 0.98 Alignments for each domain: == domain 1 score: 118.4 bits; conditional E-value: 5.9e-39 DUF446 2 vaelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwiflprmkalieaeqpLPkavaiapmaeealkeeeeeaaellallkelDel 98 v+ +L++lea Lre+++W++++p++++++st+PF++dt+e+ eWLqw+++prm+ l++++qpLP a+a+ap++e+al++++ ++a +la+l++lD+l VIMSS16876 7 VRLQLQALEALLREHQHWRNDEPQPHQFNSTQPFFMDTMEPLEWLQWVLIPRMHDLLDNKQPLPGAFAVAPYYEMALATDHPQRALILAELEKLDAL 103 6789*******************************************************************************************86 PP
Or compare VIMSS16876 to CDD or PaperBLAST