VIMSS170701 has 194 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.4e-46 141.8 0.0 4.5e-46 141.4 0.0 1.2 1 VIMSS170701
Domain annotation for each sequence (and alignments):
>> VIMSS170701
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 141.4 0.0 4.5e-46 4.5e-46 1 107 [] 77 183 .. 77 183 .. 0.99
Alignments for each domain:
== domain 1 score: 141.4 bits; conditional E-value: 4.5e-46
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsvaYqa 98
+v+la+d+++++la+dl++l+l+a++fp F+DGRgyS+a lLR+rlg+++elrA+GdvlrDql +++rcGfdaf++r+dk++++a + + ++sv Yq+
VIMSS170701 77 AVWLAPDDEPSALADDLASLPLVAVDFPVFRDGRGYSTAFLLRQRLGFARELRAIGDVLRDQLDFMRRCGFDAFAVRADKSIDDALNGFGEISVRYQG 174
69************************************************************************************************ PP
DUF934 99 avdeeqplf 107
a+de++plf
VIMSS170701 175 AIDEPRPLF 183
*******98 PP
Or compare VIMSS170701 to CDD or PaperBLAST