VIMSS17172 has 122 amino acids
Query: DUF1090 [M=110]
Accession: PF06476.17
Description: Protein of unknown function (DUF1090)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.9e-39 118.8 17.9 7.2e-39 118.5 17.9 1.0 1 VIMSS17172
Domain annotation for each sequence (and alignments):
>> VIMSS17172
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 118.5 17.9 7.2e-39 7.2e-39 4 110 .] 10 116 .. 7 116 .. 0.94
Alignments for each domain:
== domain 1 score: 118.5 bits; conditional E-value: 7.2e-39
DUF1090 4 lsllaaaaaaalsgCaaKaqaiekqlseAkahgnkarvagLekALaevkahCtdaglleereakveekeeeVaereaeLkeakekgdadkiakrkkkLa 102
++++a a++ C++K+q+i k++s+A++h n++r++gL+kAL+ev+a+C+d++l++++++k++++++eVaer+++L+eak+kgdadkiakr++kLa
VIMSS17172 10 SLFALSAGSYATTLCQEKEQNILKEISYAEKHQNQNRIDGLNKALSEVRANCSDSQLRADHQKKIAKQKDEVAERQQDLAEAKQKGDADKIAKRERKLA 108
455666667899*************************************************************************************** PP
DUF1090 103 eareeLke 110
ea+eeLk+
VIMSS17172 109 EAQEELKK 116
******96 PP
Or compare VIMSS17172 to CDD or PaperBLAST