PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1727308 to PF17496 (DUF5431)

VIMSS1727308 has 71 amino acids

Query:       DUF5431  [M=70]
Accession:   PF17496.7
Description: Family of unknown function (DUF5431)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    8.1e-42  127.6   0.1    8.9e-42  127.5   0.1    1.0  1  VIMSS1727308  


Domain annotation for each sequence (and alignments):
>> VIMSS1727308  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  127.5   0.1   8.9e-42   8.9e-42       1      70 []       1      70 [.       1      70 [. 0.99

  Alignments for each domain:
  == domain 1  score: 127.5 bits;  conditional E-value: 8.9e-42
       DUF5431  1 mseqhqdsLLprvaqGeegHEtaaKrpyLvcinrvlhvvniHvsDpkiavRdpaerRrqGGygktGLRir 70
                  ms+qhq++LLp+  qG+++HEt++KrpyLv+inrvlhvv+iH++Dp++ vR+pae+R+qG yg+ GLRir
  VIMSS1727308  1 MSDQHQYGLLPCKLQGGVNHETTGKRPYLVRINRVLHVVDIHTPDPESPVRSPAEGRIQGSYGNNGLRIR 70
                  9********************************************************************8 PP



Or compare VIMSS1727308 to CDD or PaperBLAST