VIMSS1727308 has 71 amino acids
Query: DUF5431 [M=70] Accession: PF17496.7 Description: Family of unknown function (DUF5431) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-42 127.6 0.1 8.9e-42 127.5 0.1 1.0 1 VIMSS1727308 Domain annotation for each sequence (and alignments): >> VIMSS1727308 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 127.5 0.1 8.9e-42 8.9e-42 1 70 [] 1 70 [. 1 70 [. 0.99 Alignments for each domain: == domain 1 score: 127.5 bits; conditional E-value: 8.9e-42 DUF5431 1 mseqhqdsLLprvaqGeegHEtaaKrpyLvcinrvlhvvniHvsDpkiavRdpaerRrqGGygktGLRir 70 ms+qhq++LLp+ qG+++HEt++KrpyLv+inrvlhvv+iH++Dp++ vR+pae+R+qG yg+ GLRir VIMSS1727308 1 MSDQHQYGLLPCKLQGGVNHETTGKRPYLVRINRVLHVVDIHTPDPESPVRSPAEGRIQGSYGNNGLRIR 70 9********************************************************************8 PP
Or compare VIMSS1727308 to CDD or PaperBLAST