VIMSS17333 has 59 amino acids
Query: DUF2556 [M=53]
Accession: PF10831.12
Description: Protein of unknown function (DUF2556)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7e-29 86.0 1.8 7.8e-29 85.9 1.8 1.0 1 VIMSS17333
Domain annotation for each sequence (and alignments):
>> VIMSS17333
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 85.9 1.8 7.8e-29 7.8e-29 1 53 [] 1 53 [. 1 53 [. 0.98
Alignments for each domain:
== domain 1 score: 85.9 bits; conditional E-value: 7.8e-29
DUF2556 1 mlrkyGWliafallmflfeGivmhlievltteydkcrnmdsvnPlklvkcsdl 53
m+rky Wl+ fa+++flf+ ++m ie+l+te dkcrnm+svnPlklv c +l
VIMSS17333 1 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDEL 53
9*************************************************876 PP
Or compare VIMSS17333 to CDD or PaperBLAST