VIMSS17343 has 85 amino acids
Query: DUF1488 [M=82]
Accession: PF07369.16
Description: Protein of unknown function (DUF1488)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6e-38 115.1 0.1 6.7e-38 114.9 0.1 1.0 1 VIMSS17343
Domain annotation for each sequence (and alignments):
>> VIMSS17343
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 114.9 0.1 6.7e-38 6.7e-38 1 82 [] 5 84 .. 5 84 .. 0.99
Alignments for each domain:
== domain 1 score: 114.9 bits; conditional E-value: 6.7e-38
DUF1488 1 IqFpdresydaarqaVrFpalvdgeeveCaisaeaLedhfgaeslaeedllaaFdqhRfdieevaerlieaegfdeqgtilL 82
IqFpdre++d+++++V+Fpalv+g++++Cais e L+++f++++ +e++la F+qhR+d+ee+ae+li+++ +d+qg+++L
VIMSS17343 5 IQFPDREEWDENKKCVCFPALVNGMQLTCAISGESLAYRFTGDT--PEQWLASFRQHRWDLEEEAENLIQEQSEDDQGWVWL 84
9******************************************8..9*********************************98 PP
Or compare VIMSS17343 to CDD or PaperBLAST