VIMSS17425 has 55 amino acids
Query: YhfG [M=54]
Accession: PF10832.13
Description: YhfG
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-28 84.3 1.7 2.2e-28 84.2 1.7 1.0 1 VIMSS17425
Domain annotation for each sequence (and alignments):
>> VIMSS17425
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 84.2 1.7 2.2e-28 2.2e-28 1 54 [] 2 55 .] 2 55 .] 0.99
Alignments for each domain:
== domain 1 score: 84.2 bits; conditional E-value: 2.2e-28
YhfG 1 tkltlkqKkryfaktRnaNYqASlRLEGldialvtlsaeqaaarleallrkYer 54
+klt+kqK+r+++ +Rn+N+qAS+RLEG++++lvtl+a +a+arle+l+++Yer
VIMSS17425 2 KKLTDKQKSRLWELQRNRNFQASRRLEGVEMPLVTLTAAEALARLEELRSHYER 55
79**************************************************98 PP
Or compare VIMSS17425 to CDD or PaperBLAST