VIMSS17432 has 55 amino acids
Query: DUF4223 [M=54]
Accession: PF13978.10
Description: Protein of unknown function (DUF4223)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-42 129.2 1.0 2.2e-42 129.1 1.0 1.0 1 VIMSS17432
Domain annotation for each sequence (and alignments):
>> VIMSS17432
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 129.1 1.0 2.2e-42 2.2e-42 1 54 [] 1 54 [. 1 54 [. 0.99
Alignments for each domain:
== domain 1 score: 129.1 bits; conditional E-value: 2.2e-42
DUF4223 1 mkklvkvavvaavlatLtaCtGhienkkknCsYDYLlhPaisiskiiGGCGPia 54
m+k++kva+v+avlatLtaCtGhien++knCsYDYLlhPaisiskiiGGCGP+a
VIMSS17432 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTA 54
9***************************************************97 PP
Or compare VIMSS17432 to CDD or PaperBLAST