VIMSS17572 has 190 amino acids
Query: DUF308 [M=73] Accession: PF03729.17 Description: Short repeat of unknown function (DUF308) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-23 68.4 37.2 1.3e-15 43.7 13.5 3.1 3 VIMSS17572 Domain annotation for each sequence (and alignments): >> VIMSS17572 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.7 13.5 1.3e-15 1.3e-15 2 72 .. 27 97 .. 26 98 .. 0.94 2 ! 35.3 13.3 5.5e-13 5.5e-13 1 72 [. 84 153 .. 84 154 .. 0.93 3 ! 4.7 2.9 0.0019 0.0019 13 40 .. 153 180 .. 151 190 .] 0.80 Alignments for each domain: == domain 1 score: 43.7 bits; conditional E-value: 1.3e-15 DUF308 2 lGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilyiiaGllll 72 +++ll i+G+l++ +P++++ +l++++G+ll++sGi+ +v+ f++r+++ ++ + +l+++ y+++G++++ VIMSS17572 27 IAVLLFIVGLLCISFPFVSGDILSTVVGALLICSGIALIVGLFSNRSHNFWPVLSGFLVAVAYLLIGYFFI 97 68*****************************************99998888877888************98 PP == domain 2 score: 35.3 bits; conditional E-value: 5.5e-13 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilyiiaGllll 72 l++++++++G +++ P + ++a++ +i+ l++v+G+++l++ + r+++ +g wl+l++G+l+i+++ ++l VIMSS17572 84 LVAVAYLLIGYFFIRAPELGIFAIAAFIAGLFCVAGVIRLMSWY--RQRSMKGSWLQLVIGVLDIVIAWIFL 153 5899************************************9888..66667778**************9997 PP == domain 3 score: 4.7 bits; conditional E-value: 0.0019 DUF308 13 aliwPgaallalviliGvlllvsGivql 40 + + P+++++++++l+G+ l++s++ + VIMSS17572 153 LGATPMVSVTLVSTLVGIELIFSAASLF 180 5578******************998765 PP
Or compare VIMSS17572 to CDD or PaperBLAST