VIMSS18201 has 65 amino acids
Query: DUF2065 [M=56]
Accession: PF09838.13
Description: Uncharacterized protein conserved in bacteria (DUF2065)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-25 74.7 3.2 2.8e-25 74.5 3.2 1.0 1 VIMSS18201
Domain annotation for each sequence (and alignments):
>> VIMSS18201
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.5 3.2 2.8e-25 2.8e-25 1 56 [] 5 60 .. 5 60 .. 0.97
Alignments for each domain:
== domain 1 score: 74.5 bits; conditional E-value: 2.8e-25
DUF2065 1 LllAlGLvLviEGllpflaPerwrrmlaqlaelpdgqLRliGlvsmllGllllwlv 56
++lAl+LvLv+EGl p+l+P++w++m+ ++++lpd+ LR++G++++++G+++++++
VIMSS18201 5 IWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML 60
689**************************************************985 PP
Or compare VIMSS18201 to CDD or PaperBLAST