VIMSS1837 has 509 amino acids
Query: DUF5060 [M=70]
Accession: PF16586.9
Description: Domain of unknown function (DUF5060)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6e-30 89.7 0.8 6e-30 89.7 0.8 2.0 2 VIMSS1837
Domain annotation for each sequence (and alignments):
>> VIMSS1837
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 89.7 0.8 6e-30 6e-30 1 69 [. 8 75 .. 8 76 .. 0.97
2 ? -3.9 0.1 0.95 0.95 48 55 .. 176 183 .. 172 187 .. 0.60
Alignments for each domain:
== domain 1 score: 89.7 bits; conditional E-value: 6e-30
DUF5060 1 evekWevveltlkaeseyanPftdvelsatFthesgrsitvpGFydGdgayrvrFmPdeeGewtYktss 69
+vekW+++e+tlk+++e +nPftdve++a+Ft+e g+s++v+GFydG++++++rFmP+++G w+Y+++s
VIMSS1837 8 NVEKWGTYEITLKGKAE-GNPFTDVEIKAVFTSEAGDSFEVEGFYDGEDTFKIRFMPNRTGLWKYEVRS 75
59***************.*************************************************98 PP
== domain 2 score: -3.9 bits; conditional E-value: 0.95
DUF5060 48 dgayrvrF 55
dg+y+v F
VIMSS1837 176 DGRYQVEF 183
45566666 PP
Or compare VIMSS1837 to CDD or PaperBLAST