VIMSS186050 has 342 amino acids
Query: DUF1751 [M=99] Accession: PF08551.14 Description: Eukaryotic integral membrane protein (DUF1751) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-09 22.6 0.2 6.3e-09 22.6 0.2 2.7 3 VIMSS186050 Domain annotation for each sequence (and alignments): >> VIMSS186050 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.16 0.16 58 72 .. 155 169 .. 148 192 .. 0.71 2 ! 22.6 0.2 6.3e-09 6.3e-09 9 65 .. 204 260 .. 194 268 .. 0.90 3 ? -0.9 0.3 0.13 0.13 56 87 .. 294 325 .. 292 333 .. 0.63 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.16 DUF1751 58 tnllvvlltlllylv 72 n+l++l++l+++++ VIMSS186050 155 LNILAFLVCLIVATA 169 466666666666554 PP == domain 2 score: 22.6 bits; conditional E-value: 6.3e-09 DUF1751 9 wtlltasfvelnvfkvlvslltLllggkylErlWgskEllkFilvvnvitnllvvll 65 + l+t+ f ++++l+++ +L+++g ++Er+ g+k +l +v ++++++ + + VIMSS186050 204 YRLVTSMFLHGGIVHLLFNMYALYILGDFIERIYGAKKYLAIYFVSGIVASIFSLYF 260 689**********************************99999999999999887665 PP == domain 3 score: -0.9 bits; conditional E-value: 0.13 DUF1751 56 vitnllvvlltlllylvtkseelllvplsGli 87 ++tn++v++l ++ ++ s+ + +++ G+i VIMSS186050 294 LVTNIIVIILLNVFIGLSMSNIDISARFGGFI 325 57888877766666555554444667777765 PP
Or compare VIMSS186050 to CDD or PaperBLAST