VIMSS18607 has 404 amino acids
Query: GmrSD_C [M=138] Accession: PF07510.16 Description: GmrSD restriction endonucleases, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-24 71.3 4.5 7.3e-24 70.4 4.5 1.5 1 VIMSS18607 Domain annotation for each sequence (and alignments): >> VIMSS18607 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.4 4.5 7.3e-24 7.3e-24 4 138 .] 250 392 .. 247 392 .. 0.93 Alignments for each domain: == domain 1 score: 70.4 bits; conditional E-value: 7.3e-24 GmrSD_C 4 ddefkrdltdkkfykksskklryillgrleedlyeedeikgsskket...iEHilPqslaekw......gageddeeereelvndlgNLtlltgslNsa 93 ++++ ++++ ++ ++s++++yi+ ++ ++++ d +k ++k++ EHi P +l +++ + g++d+++ e+++++ gNL+ l++slN++ VIMSS18607 250 RNDIGLAFWQSVNNASNSSCFHYIFFEKNCQEMGLADLKKLIPRKQFsqeKEHIIPINLLKQEsnnkirDLGFEDKKDLEDYIDTYGNLISLEKSLNRK 348 5667778888888888999***********99998899999888888999***********999*********************************** PP GmrSD_C 94 isnkdfleKrekyeksclyltrkladkdkwneeviearqeaLakv 138 +s+kd K+e y++s+++ +r++ d++++n++++ +r+e++ ++ VIMSS18607 349 ASDKDLYGKDEIYKSSEIPFNRRF-DTKNFNKKALVKRNEEMREW 392 ************************.799**************986 PP
Or compare VIMSS18607 to CDD or PaperBLAST