VIMSS1881637 has 462 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-22 65.1 2.8 7.1e-22 64.0 2.8 1.5 1 VIMSS1881637 Domain annotation for each sequence (and alignments): >> VIMSS1881637 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.0 2.8 7.1e-22 7.1e-22 14 135 .. 277 399 .. 264 401 .. 0.84 Alignments for each domain: == domain 1 score: 64.0 bits; conditional E-value: 7.1e-22 EryCIII-like_C 14 ivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiaka 108 ++v+l + + nvR+ fvP g +l +aa+v hgG g ++ al +GvP v +p + d++ arrv++ Gagi+ls + lt+d +++a VIMSS1881637 277 VLVTLADAHGRVDLPAAANVRTERFVPHGPVLARAAAVVCHGGMGIVHKALAAGVPIVAVPFGRDQPEVARRVVQAGAGISLSAKRLTPDGLRTA 371 566665555444445578***************************************************************************** PP EryCIII-like_C 109 vaevvedpay.raaaaklaeeiaaePsP 135 ++ ++ +a +a+ +l++ + ++ +P VIMSS1881637 372 LHAAMAGRAAsAEASRRLRAFVEDQSAP 399 *988777765156677788766555555 PP
Or compare VIMSS1881637 to CDD or PaperBLAST