VIMSS189222 has 334 amino acids
Query: DUF1297 [M=188] Accession: PF06973.16 Description: Domain of unknown function (DUF1297) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-81 258.9 0.0 1.5e-81 258.6 0.0 1.1 1 VIMSS189222 Domain annotation for each sequence (and alignments): >> VIMSS189222 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 258.6 0.0 1.5e-81 1.5e-81 1 188 [] 150 334 .] 150 334 .] 0.98 Alignments for each domain: == domain 1 score: 258.6 bits; conditional E-value: 1.5e-81 DUF1297 1 efeekleellekglieeedlkeasieeyvvGanfnlnyFysplkeevellgidrRyesnldglvrlpakeqleleiepeyvvvGnipvvlREsllekv 98 +f++k+e++l g+ ++edlk+++i+eyv+G++++ +yFys+++ee+el++idrRyesn+d + r+pak+qle++++++y+v+Gnip+vlREsll +v VIMSS189222 150 DFWRKAEKFL--GIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDV 245 6888888887..78899********************************************************************************* PP DUF1297 99 felgekfveaakklvppGiiGpFcLqsvvtedlelvvfevsaRivggtnvymegspyskllfgepmsmGrriarEikeaiekdrleevvt 188 +e+ge++v+aa++l+ G++GpFcL+ v+t+dle+vvfe+saRiv+gtn++++gspy++l +++p+s+Grria+Ei+eaie+d+le+v+t VIMSS189222 246 IEAGERVVKAAEELMG-GLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT 334 ************9987.***********************************************************************98 PP
Or compare VIMSS189222 to CDD or PaperBLAST