PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1956189 to PF04301 (BioG)

VIMSS1956189 has 203 amino acids

Query:       BioG  [M=213]
Accession:   PF04301.17
Description: Pimeloyl-ACP methyl esterase BioG
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.8e-26   78.0   0.0    5.2e-26   77.6   0.0    1.1  1  VIMSS1956189  


Domain annotation for each sequence (and alignments):
>> VIMSS1956189  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   77.6   0.0   5.2e-26   5.2e-26       7     211 ..       9     201 ..       2     203 .] 0.85

  Alignments for each domain:
  == domain 1  score: 77.6 bits;  conditional E-value: 5.2e-26
          BioG   7 sqqgdnlilyfagwgtppdvvehlilpenydlllcydyrdlnldvdfsayrhirlvawsmgvwvaervlqgirlksatavngtglpcddqygipeav 103
                   +++ ++lil f g+ + p+   hl    + +++l+ydy++l+  +d+ ++ +i l+a+smgv va rvl+ i++    a+ngt +  d   gi  a+
  VIMSS1956189   9 NENSQELILVFGGFASHPSHFAHLKS--DKNVVLVYDYENLDFKFDLKSFSKITLIAFSMGVCVASRVLKDIEFSQKIAINGTPFGIDKLKGIHPAI 103
                   677899*****************865..5668999************************************************************** PP

          BioG 104 fkgtlenltedtrlkferricgdkalledyqqysarptlqeihaelialyallqqdrrtdlirwskalvgskdkifmaanqraywtdrcavreidve 200
                   f+  +++++    + f++ +  ++   ++ +++  +   +++++el  l+ + +++   ++i w k     +d if+ +  ++ +++      ++  
  VIMSS1956189 104 FAKQIKKFD---LTAFKKSLFKERK--NEAKNFIFKD-EKDLKTELEKLFEFASKECNENFI-WDKIYSSNNDEIFPQNALKNTFSKLIF---LNEP 190
                   **9887664...5567776665443..4556666666.67899***********99998887.*************98877777766554...5668 PP

          BioG 201 hllfsrfthwe 211
                   h+ f +f  w+
  VIMSS1956189 191 HFAFFHFKTWD 201
                   99999999997 PP



Or compare VIMSS1956189 to CDD or PaperBLAST