VIMSS1956343 has 216 amino acids
Query: DUF374 [M=69]
Accession: PF04028.17
Description: Domain of unknown function (DUF374)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-32 97.1 0.0 2.8e-32 96.5 0.0 1.3 1 VIMSS1956343
Domain annotation for each sequence (and alignments):
>> VIMSS1956343
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 96.5 0.0 2.8e-32 2.8e-32 1 69 [] 65 133 .. 65 133 .. 0.98
Alignments for each domain:
== domain 1 score: 96.5 bits; conditional E-value: 2.8e-32
DUF374 1 lrkrkkkiaaliSrsrDGeliarvlerlgiktvrGSssrggaralremlralkeGesiaiTpDGPrGPr 69
+r+++kk++++iS+++DGe ia++++ +g++tvrGS+srg+ +alr++ + l+++++i+iTpDGPrGP+
VIMSS1956343 65 YRQKNKKAYVMISHHKDGEQIAKIIKLFGLDTVRGSTSRGASSALRAAFKVLEQNDDIVITPDGPRGPY 133
6889****************************************************************5 PP
Or compare VIMSS1956343 to CDD or PaperBLAST