VIMSS200537 has 379 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.6e-26 76.3 0.3 1.9e-25 75.4 0.3 1.5 1 VIMSS200537
Domain annotation for each sequence (and alignments):
>> VIMSS200537
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 75.4 0.3 1.9e-25 1.9e-25 1 78 [. 13 90 .. 13 91 .. 0.96
Alignments for each domain:
== domain 1 score: 75.4 bits; conditional E-value: 1.9e-25
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R Id +D++ll+Ll +R++l+ +++ +K+++glp++ p+Re+++l+++re+a+ +g+ p+++e+i+r++++es +
VIMSS200537 13 RGLIDGVDQQLLHLLRKRLDLVAQVGTVKHAAGLPIYAPQREAAMLAKRREEAQTMGIAPQLIEDILRRLMRESYLNE 90
667**********************************************************************98665 PP
Or compare VIMSS200537 to CDD or PaperBLAST