PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS200785 to PF04287 (DUF446)

VIMSS200785 has 107 amino acids

Query:       DUF446  [M=98]
Accession:   PF04287.16
Description: tRNA pseudouridine synthase C
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.7e-39  117.9   1.6    9.8e-39  117.7   1.6    1.0  1  VIMSS200785  


Domain annotation for each sequence (and alignments):
>> VIMSS200785  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  117.7   1.6   9.8e-39   9.8e-39       3      97 ..       8     101 ..       6     102 .. 0.97

  Alignments for each domain:
  == domain 1  score: 117.7 bits;  conditional E-value: 9.8e-39
       DUF446   3 aelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwvfiprmkalieaeqpLPkavaiapmaeealkeeeeekeellallkelDe 97 
                  +++L ++ +eL++++lW+++aps ea+ast+PFa+d + fe+WLq++fiprm+ali+a+q+LP+++aiapmae+ ++e+++  + l+++l+elD 
  VIMSS200785   8 QTKLAQIASELKQTGLWSATAPSVEAMASTAPFACDLMPFEQWLQFIFIPRMQALIDAGQALPSQIAIAPMAEHLWSEQAA-LAPLISTLNELDI 101
                  689****************************************************************************99.***********96 PP



Or compare VIMSS200785 to CDD or PaperBLAST