VIMSS201330 has 72 amino acids
Query: DUF1414 [M=44]
Accession: PF07208.15
Description: Protein of unknown function (DUF1414)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-27 82.0 0.1 1.8e-27 81.4 0.1 1.3 1 VIMSS201330
Domain annotation for each sequence (and alignments):
>> VIMSS201330
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.4 0.1 1.8e-27 1.8e-27 1 44 [] 26 69 .. 26 69 .. 0.99
Alignments for each domain:
== domain 1 score: 81.4 bits; conditional E-value: 1.8e-27
DUF1414 1 HkApvDLsLMvLGNlvTnilnqsVpeaqReaiAekFaqALksSv 44
HkAp+DLsLM+LGN+vT++l+ +Vp++ R+a+Ae+Fa+AL +Sv
VIMSS201330 26 HKAPTDLSLMALGNCVTHLLERKVPSESRQAVAEQFAKALAQSV 69
9******************************************8 PP
Or compare VIMSS201330 to CDD or PaperBLAST