VIMSS2018048 has 88 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-26 78.2 3.6 2.9e-26 78.0 3.6 1.0 1 VIMSS2018048
Domain annotation for each sequence (and alignments):
>> VIMSS2018048
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.0 3.6 2.9e-26 2.9e-26 1 78 [. 7 83 .. 7 84 .. 0.96
Alignments for each domain:
== domain 1 score: 78.0 bits; conditional E-value: 2.9e-26
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+eId+iD+++++Ll+eRm+l++ + +yKk++g+p+ld++Ree ++e++r+ e + ++e++ + f +i++ sr++Q
VIMSS2018048 7 RQEIDQIDDQIVKLLEERMHLVEGVVAYKKASGKPILDTKREEVIFEKVRSRV-EDKRYQETIVATFSDILKRSRDYQ 83
9**************************************************54.678999*****************9 PP
Or compare VIMSS2018048 to CDD or PaperBLAST