VIMSS2018561 has 177 amino acids
Query: DUF402 [M=68] Accession: PF04167.17 Description: Protein of unknown function (DUF402) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-22 64.6 2.9 3.9e-22 64.6 2.9 2.4 2 VIMSS2018561 Domain annotation for each sequence (and alignments): >> VIMSS2018561 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.6 2.9 3.9e-22 3.9e-22 2 68 .] 60 124 .. 59 124 .. 0.97 2 ? 2.0 0.2 0.013 0.013 13 32 .. 147 166 .. 136 175 .. 0.80 Alignments for each domain: == domain 1 score: 64.6 bits; conditional E-value: 3.9e-22 DUF402 2 lalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68 +a+++++++ w+n+++++++ ++ +Y+n+a+p +++e+++kyiD++LDv+++ dge ++lD++E+ VIMSS2018561 60 PAIVYFHKKYWFNIIAMIRD--NGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEY 124 799****************9..9**************99***************************7 PP == domain 2 score: 2.0 bits; conditional E-value: 0.013 DUF402 13 ynvtkfldedgrlkgwYvni 32 + v + +++g + + Yvni VIMSS2018561 147 ILVDWINNGRGPFSEAYVNI 166 557788889999*******9 PP
Or compare VIMSS2018561 to CDD or PaperBLAST